PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040373
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 230aa    MW: 24918.6 Da    PI: 8.1352
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040373genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42771761100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+ +l+aela+++
  Lus10040373  77 PCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQIGELQAELAKAR 174
                  7**********************************************************************************************998 PP

       DUF260  99 ee 100
                  +e
  Lus10040373 175 AE 176
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09676177IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4277174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGINVISDHD YDHQMMIKAS SSPITVPING YSSPPPSTPP YNSHHSSTST SPTPAANISN  60
MNSMSPPPPA APVIMSPCAA CKILRRRCVD KCVLAPYFPP TDPLKFTIAH RVFGASNIIK  120
FLQELPESQR ADAVSSMVYE ANARIRDPVY GCAGAICQLQ KQIGELQAEL AKARAEVVNM  180
QSQQASLVGF YMEMIQTASS LDQEPPSIFF PNGLQPHQMQ PIGHALKRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488170.16e-76PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK086e-69LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0K9RV841e-76A0A0K9RV84_SPIOL; Uncharacterized protein
STRINGVIT_13s0019g03700.t013e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-66LOB domain-containing protein 11